Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333289.1	5prime_partial	154	2-466(+)
Amino Acid sequence :
GCGICRIGGSKNFFHCNKCGCCYSALLSSSHPCVERAMHQDCPVCFEYLFESRNDVIALPCGHTIHKACLEEMQEHYQYACPICSKSVCDMSKVWEKFDMEIAATPMPSYCENKMVWILC NDCGCNSEVKYHVVAHKCPKCKSYNTRQTRGFGR*
Physicochemical properties
Number of amino acids:		154
Molecular weight:		12,270.460
Theoretical pI:		6.118
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23490 23990
Instability index:		85.362
aromaticity		0.046
GRAVY		-0.998
Secondary Structure Fraction
Helix		0.128
turn		0.321
sheet		0.211

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333289.1	3prime_partial	109	329-3(-)
Amino Acid sequence :
MMALESLQSPCRTSPTLLTCHKPTWSRWGKHTDNAPASPPGTPCEWCARMEERSHHSSTQTDTQNKLDNLDALPSPHMDDCCLEEQNSSNHICYSGRNSWSPQSCRCHS
Physicochemical properties
Number of amino acids:		109
Molecular weight:		12,270.460
Theoretical pI:		6.118
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23490 23990
Instability index:		85.362
aromaticity		0.046
GRAVY		-0.998
Secondary Structure Fraction
Helix		0.128
turn		0.321
sheet		0.211