| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333303.1 | internal | 267 | 1-801(+) |
Amino Acid sequence : | |||
| DRRSYRRHRPAATTTHLPRRRNTTAEGHRRRPFVELNPSCTPCTAAPCARHTPTTIPCNFESQRIEFWDIYWKMEIDFNEVPFDLDFHPSRNLVASCLITGHLLLYGYGPEAKPQKLLEV KAHTESCRAIRFINNGHVIVTGSSDRSILATDVETGTTIARLDESHAHPVNRIVNLTESTIASGDDEGFIKVWDNRQRSCCSIFNVHEDYISDMTFASDSMKLLGISGDGTLSVCNLRSN KVQTRSEFSEDELLSVVIMKNGRKVIC | |||
Physicochemical properties | |||
| Number of amino acids: | 267 | ||
| Molecular weight: | 30,194.789 | ||
| Theoretical pI: | 7.267 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24575 | ||
| Instability index: | 55.305 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.431 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.236 | ||
| sheet | 0.206 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333303.1 | internal | 267 | 1-801(+) |
Amino Acid sequence : | |||
| DRRSYRRHRPAATTTHLPRRRNTTAEGHRRRPFVELNPSCTPCTAAPCARHTPTTIPCNFESQRIEFWDIYWKMEIDFNEVPFDLDFHPSRNLVASCLITGHLLLYGYGPEAKPQKLLEV KAHTESCRAIRFINNGHVIVTGSSDRSILATDVETGTTIARLDESHAHPVNRIVNLTESTIASGDDEGFIKVWDNRQRSCCSIFNVHEDYISDMTFASDSMKLLGISGDGTLSVCNLRSN KVQTRSEFSEDELLSVVIMKNGRKVIC | |||
Physicochemical properties | |||
| Number of amino acids: | 267 | ||
| Molecular weight: | 30,194.789 | ||
| Theoretical pI: | 7.267 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24575 | ||
| Instability index: | 55.305 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.431 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.236 | ||
| sheet | 0.206 | ||