Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333329.1 | 3prime_partial | 237 | 72-782(+) |
Amino Acid sequence : | |||
MADQRKFPSISEKVATQLHLRSTISQVRNGVAPQTALSQRRFAYGNYSNPGFQYPMTQELSMISANASPVFVQAPQEKGLSGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIRA GRLSEPYKGIGDCFKRTMQEEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLGYARTRLANDAKAAKKGGERQFNGLVDV | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 26,216.564 | ||
Theoretical pI: | 9.926 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 29910 | ||
Instability index: | 27.076 | ||
aromaticity | 0.122 | ||
GRAVY | -0.324 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.257 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333329.1 | 3prime_partial | 237 | 72-782(+) |
Amino Acid sequence : | |||
MADQRKFPSISEKVATQLHLRSTISQVRNGVAPQTALSQRRFAYGNYSNPGFQYPMTQELSMISANASPVFVQAPQEKGLSGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIRA GRLSEPYKGIGDCFKRTMQEEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLGYARTRLANDAKAAKKGGERQFNGLVDV | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 26,216.564 | ||
Theoretical pI: | 9.926 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 29910 | ||
Instability index: | 27.076 | ||
aromaticity | 0.122 | ||
GRAVY | -0.324 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.257 | ||
sheet | 0.257 |