| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333338.1 | internal | 267 | 803-3(-) |
Amino Acid sequence : | |||
| TWIRRELPGGRASFIHVFEPVEDGQTRGANVFYSVMEQMKMLDTLQNTQLQSAIVKAMYAATIESELDTQSAMDFILGANSQEQRERLTGWIGEIAAYYAAAPVRLGGAKVPHLMPGDSL NLQTAQDTDNGYSVFEQSLLRYIAAGLGVSYEQLSRNYAQMSYSTARASANESWAYFMGRRKFVASRQASQMFLCWLEEAIVRRVVTLPSKARFSFQEARSAWGNCDWIGSGRMAIDGLK EVQEAVMLIEAGLSTYEKECAKRGDDY | |||
Physicochemical properties | |||
| Number of amino acids: | 267 | ||
| Molecular weight: | 29,872.443 | ||
| Theoretical pI: | 5.408 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51005 | ||
| Instability index: | 59.119 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.273 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.210 | ||
| sheet | 0.315 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333338.1 | internal | 267 | 803-3(-) |
Amino Acid sequence : | |||
| TWIRRELPGGRASFIHVFEPVEDGQTRGANVFYSVMEQMKMLDTLQNTQLQSAIVKAMYAATIESELDTQSAMDFILGANSQEQRERLTGWIGEIAAYYAAAPVRLGGAKVPHLMPGDSL NLQTAQDTDNGYSVFEQSLLRYIAAGLGVSYEQLSRNYAQMSYSTARASANESWAYFMGRRKFVASRQASQMFLCWLEEAIVRRVVTLPSKARFSFQEARSAWGNCDWIGSGRMAIDGLK EVQEAVMLIEAGLSTYEKECAKRGDDY | |||
Physicochemical properties | |||
| Number of amino acids: | 267 | ||
| Molecular weight: | 29,872.443 | ||
| Theoretical pI: | 5.408 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51005 | ||
| Instability index: | 59.119 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.273 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.210 | ||
| sheet | 0.315 | ||