Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333338.1 | internal | 267 | 803-3(-) |
Amino Acid sequence : | |||
TWIRRELPGGRASFIHVFEPVEDGQTRGANVFYSVMEQMKMLDTLQNTQLQSAIVKAMYAATIESELDTQSAMDFILGANSQEQRERLTGWIGEIAAYYAAAPVRLGGAKVPHLMPGDSL NLQTAQDTDNGYSVFEQSLLRYIAAGLGVSYEQLSRNYAQMSYSTARASANESWAYFMGRRKFVASRQASQMFLCWLEEAIVRRVVTLPSKARFSFQEARSAWGNCDWIGSGRMAIDGLK EVQEAVMLIEAGLSTYEKECAKRGDDY | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 29,872.443 | ||
Theoretical pI: | 5.408 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51005 | ||
Instability index: | 59.119 | ||
aromaticity | 0.105 | ||
GRAVY | -0.273 | ||
Secondary Structure Fraction | |||
Helix | 0.285 | ||
turn | 0.210 | ||
sheet | 0.315 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333338.1 | internal | 267 | 803-3(-) |
Amino Acid sequence : | |||
TWIRRELPGGRASFIHVFEPVEDGQTRGANVFYSVMEQMKMLDTLQNTQLQSAIVKAMYAATIESELDTQSAMDFILGANSQEQRERLTGWIGEIAAYYAAAPVRLGGAKVPHLMPGDSL NLQTAQDTDNGYSVFEQSLLRYIAAGLGVSYEQLSRNYAQMSYSTARASANESWAYFMGRRKFVASRQASQMFLCWLEEAIVRRVVTLPSKARFSFQEARSAWGNCDWIGSGRMAIDGLK EVQEAVMLIEAGLSTYEKECAKRGDDY | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 29,872.443 | ||
Theoretical pI: | 5.408 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51005 | ||
Instability index: | 59.119 | ||
aromaticity | 0.105 | ||
GRAVY | -0.273 | ||
Secondary Structure Fraction | |||
Helix | 0.285 | ||
turn | 0.210 | ||
sheet | 0.315 |