Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333339.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
TWIPRELPGGRASFIHVFEPVEDGQTRGANVFYSVMEQMKMLDTLQNTQLQSAIVKAMYAATIESELDTQSAMDFILGANSQEQRERLTGWIGEIAAYYAAAPVRLGGAKVPHLMPGDSL NLQTAQDTDNGYSVFEQSLLRYIAAGLGVSYEQLSRNYAQMSYSTARASANESWAYFMGRRKFVASRQASQMFLCWLEEAIVRRVVTLPSKARFSFQEARSAWGNCDWIGSGRMAIDGLK EVQEAVML | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 27,683.081 | ||
Theoretical pI: | 5.537 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48025 | ||
Instability index: | 55.940 | ||
aromaticity | 0.105 | ||
GRAVY | -0.200 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.218 | ||
sheet | 0.315 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333339.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
TWIPRELPGGRASFIHVFEPVEDGQTRGANVFYSVMEQMKMLDTLQNTQLQSAIVKAMYAATIESELDTQSAMDFILGANSQEQRERLTGWIGEIAAYYAAAPVRLGGAKVPHLMPGDSL NLQTAQDTDNGYSVFEQSLLRYIAAGLGVSYEQLSRNYAQMSYSTARASANESWAYFMGRRKFVASRQASQMFLCWLEEAIVRRVVTLPSKARFSFQEARSAWGNCDWIGSGRMAIDGLK EVQEAVML | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 27,683.081 | ||
Theoretical pI: | 5.537 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48025 | ||
Instability index: | 55.940 | ||
aromaticity | 0.105 | ||
GRAVY | -0.200 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.218 | ||
sheet | 0.315 |