| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333339.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
| TWIPRELPGGRASFIHVFEPVEDGQTRGANVFYSVMEQMKMLDTLQNTQLQSAIVKAMYAATIESELDTQSAMDFILGANSQEQRERLTGWIGEIAAYYAAAPVRLGGAKVPHLMPGDSL NLQTAQDTDNGYSVFEQSLLRYIAAGLGVSYEQLSRNYAQMSYSTARASANESWAYFMGRRKFVASRQASQMFLCWLEEAIVRRVVTLPSKARFSFQEARSAWGNCDWIGSGRMAIDGLK EVQEAVML | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 27,683.081 | ||
| Theoretical pI: | 5.537 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48025 | ||
| Instability index: | 55.940 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.218 | ||
| sheet | 0.315 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333339.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
| TWIPRELPGGRASFIHVFEPVEDGQTRGANVFYSVMEQMKMLDTLQNTQLQSAIVKAMYAATIESELDTQSAMDFILGANSQEQRERLTGWIGEIAAYYAAAPVRLGGAKVPHLMPGDSL NLQTAQDTDNGYSVFEQSLLRYIAAGLGVSYEQLSRNYAQMSYSTARASANESWAYFMGRRKFVASRQASQMFLCWLEEAIVRRVVTLPSKARFSFQEARSAWGNCDWIGSGRMAIDGLK EVQEAVML | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 27,683.081 | ||
| Theoretical pI: | 5.537 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48025 | ||
| Instability index: | 55.940 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.218 | ||
| sheet | 0.315 | ||