| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333347.1 | internal | 259 | 3-779(+) |
Amino Acid sequence : | |||
| RFHQLLVRDPHPQMASAFVSLTSASPLPSIDPLKGNQKFGASSQATFFGRNFIKAKSFTRTSMTVAVEVSRFNEVTMAPPDPILGVSEAFRADTNELKLNLGVGAYRTEDLQPYVLNVVK KAENLMLERGENKEYLPIEGLAAFNKVTAELLFGTDSPVLQEQRVATVQGLSGTGSLRLAAVLIQRYFPGSKVLISSPTWGNHKNIFNDAQVPWSEYRYYDPKTVGLDFDGMISDIKAAP ERSFVLLHGCAHNPTGIDL | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 28,504.150 | ||
| Theoretical pI: | 7.152 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 33.717 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.263 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333347.1 | internal | 259 | 3-779(+) |
Amino Acid sequence : | |||
| RFHQLLVRDPHPQMASAFVSLTSASPLPSIDPLKGNQKFGASSQATFFGRNFIKAKSFTRTSMTVAVEVSRFNEVTMAPPDPILGVSEAFRADTNELKLNLGVGAYRTEDLQPYVLNVVK KAENLMLERGENKEYLPIEGLAAFNKVTAELLFGTDSPVLQEQRVATVQGLSGTGSLRLAAVLIQRYFPGSKVLISSPTWGNHKNIFNDAQVPWSEYRYYDPKTVGLDFDGMISDIKAAP ERSFVLLHGCAHNPTGIDL | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 28,504.150 | ||
| Theoretical pI: | 7.152 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 33.717 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.263 | ||
| sheet | 0.263 | ||