| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333350.1 | 5prime_partial | 153 | 3-464(+) |
Amino Acid sequence : | |||
| FLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAFIINKLQLFHGGSALIIDDPNDAVEISRAYVSLCRSLTGGLVDAHIGDQLGH ELFSRLLSQAVDQAKELMDQFQLVHIVASLTLA* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 17,020.063 | ||
| Theoretical pI: | 4.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 39.401 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.353 | ||
| turn | 0.203 | ||
| sheet | 0.288 | ||