Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333355.1 | 5prime_partial | 258 | 1-777(+) |
Amino Acid sequence : | |||
LLISLIKFRSISLSRLQHSISMGAEIPGIVKLKCSVKNYDWGKPGKESTVARLYARNSGHEVDDEEPYAEFWMGTHDSGPSYVVAAAEATAGPPESGVEVKNACDREKGDLVSLKDWIER NPTVLGDKVLQKWGPSLPFLFKVLSVLKALSIQAHPDKDLAAILHKEQPEMYKDGNHKPEMALALTEFEALCGFVGLEELKSVIRNVPEITEVVGSSYADQVLNNSDEGDKKSKVVLQSL FTGLMSASKAMISEIIPK* | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 12,714.535 | ||
Theoretical pI: | 11.805 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 87.484 | ||
aromaticity | 0.080 | ||
GRAVY | -0.411 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.354 | ||
sheet | 0.186 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333355.1 | 5prime_partial | 113 | 2-343(+) |
Amino Acid sequence : | |||
CSFLSSNSVPFLSLDSNIPFPWAPKFQESSNSSAPSKTMTGESLGRNPLWRGCMQGTVVTRSTMKNRTLSFGWGLTTPVLLTSLQRRKRLPDRRSPAWRSRMPVIVRREISSV* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,714.535 | ||
Theoretical pI: | 11.805 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 87.484 | ||
aromaticity | 0.080 | ||
GRAVY | -0.411 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.354 | ||
sheet | 0.186 |