| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333362.1 | 5prime_partial | 271 | 825-10(-) |
Amino Acid sequence : | |||
| QGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGG PHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGMARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMISINLDLKRGGNGRF LKTAAYGHFGRDDADFTWEVVKPLKWDKPQA* | |||
Physicochemical properties | |||
| Number of amino acids: | 271 | ||
| Molecular weight: | 15,905.197 | ||
| Theoretical pI: | 9.407 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 37.620 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.210 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333362.1 | 3prime_partial | 143 | 397-825(+) |
Amino Acid sequence : | |||
| MSSPATIRVDDDLSTSETSITVRTSNHKPARRVEVENGLLIKVLLRDNRLDHMLLQICSNLIICHSLVVLCGDQHSVDADRNHRTVLVVVLDGHLSLAVRPQPRARPVFPDLSETGAELR GKNMAQRHQLRGFIRGVAKHVAL | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 15,905.197 | ||
| Theoretical pI: | 9.407 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 37.620 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.210 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333362.1 | 5prime_partial | 271 | 825-10(-) |
Amino Acid sequence : | |||
| QGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGG PHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGMARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMISINLDLKRGGNGRF LKTAAYGHFGRDDADFTWEVVKPLKWDKPQA* | |||
Physicochemical properties | |||
| Number of amino acids: | 271 | ||
| Molecular weight: | 15,905.197 | ||
| Theoretical pI: | 9.407 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 37.620 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.210 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333362.1 | 3prime_partial | 143 | 397-825(+) |
Amino Acid sequence : | |||
| MSSPATIRVDDDLSTSETSITVRTSNHKPARRVEVENGLLIKVLLRDNRLDHMLLQICSNLIICHSLVVLCGDQHSVDADRNHRTVLVVVLDGHLSLAVRPQPRARPVFPDLSETGAELR GKNMAQRHQLRGFIRGVAKHVAL | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 15,905.197 | ||
| Theoretical pI: | 9.407 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 37.620 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.210 | ||
| sheet | 0.252 | ||