Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333377.1 | internal | 260 | 2-781(+) |
Amino Acid sequence : | |||
ELQMISFITFPLLFFLLLLLWKYLQKPKKNFPPSPQKLPIIGNLHQLSPLPHQDFDSMARKHGPLMLLHFGKVPVLVVSSADAACAIMKAHDLTFSSRPQYKTFKKLFYNCREVAFSPYS EYSRQMKSVFVLHLLSAKRVQSFRSIREEETALFVKRVEESIGPVNLSDMFGEFTNDVICRSAFGEKFRESEKGKKLVWLLREIIALLGMISLGDFIPWLGWIDRVNGLDKRLDRVAREM DDFLNDVIDERVEVIKGGNL | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 14,076.139 | ||
Theoretical pI: | 11.586 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 53.522 | ||
aromaticity | 0.087 | ||
GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.346 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333377.1 | 5prime_partial | 127 | 780-397(-) |
Amino Acid sequence : | |||
RFPPLITSTRSSITSFKKSSISLATLSSLLSKPLTRSIQPSHGIKSPKLIIPKRAIISLNNHTSFFPFSDSLNFSPKADLQITSFVNSPNMSLRFTGPIDSSTLFTKRAVSSSLMERKDW TLFALSR* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,076.139 | ||
Theoretical pI: | 11.586 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 53.522 | ||
aromaticity | 0.087 | ||
GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.346 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333377.1 | internal | 260 | 2-781(+) |
Amino Acid sequence : | |||
ELQMISFITFPLLFFLLLLLWKYLQKPKKNFPPSPQKLPIIGNLHQLSPLPHQDFDSMARKHGPLMLLHFGKVPVLVVSSADAACAIMKAHDLTFSSRPQYKTFKKLFYNCREVAFSPYS EYSRQMKSVFVLHLLSAKRVQSFRSIREEETALFVKRVEESIGPVNLSDMFGEFTNDVICRSAFGEKFRESEKGKKLVWLLREIIALLGMISLGDFIPWLGWIDRVNGLDKRLDRVAREM DDFLNDVIDERVEVIKGGNL | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 14,076.139 | ||
Theoretical pI: | 11.586 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 53.522 | ||
aromaticity | 0.087 | ||
GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.346 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333377.1 | 5prime_partial | 127 | 780-397(-) |
Amino Acid sequence : | |||
RFPPLITSTRSSITSFKKSSISLATLSSLLSKPLTRSIQPSHGIKSPKLIIPKRAIISLNNHTSFFPFSDSLNFSPKADLQITSFVNSPNMSLRFTGPIDSSTLFTKRAVSSSLMERKDW TLFALSR* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,076.139 | ||
Theoretical pI: | 11.586 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 53.522 | ||
aromaticity | 0.087 | ||
GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.346 | ||
sheet | 0.181 |