Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333379.1 | internal | 267 | 1-801(+) |
Amino Acid sequence : | |||
QLHAQAWDHALSYIKPTALSAAVELEIPDILENHGGPMTLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTTENLGPYMLMQATPVTRCPTGLSGEALKTGTSLYLK SIRGEDSWSDPAYGYHMKAFTNAMTAHARLTAAAIVRNYPAAFDGVQSVVDVGSRHGTAIGKLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDDK CIEILKKCKEAIPANIGKVMIVDAIIN | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 14,378.198 | ||
Theoretical pI: | 11.611 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 79.288 | ||
aromaticity | 0.137 | ||
GRAVY | -0.868 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.214 | ||
sheet | 0.111 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333379.1 | complete | 125 | 408-31(-) |
Amino Acid sequence : | |||
MVAVGRVTPRILTSDRLQIKACPRFQGFAAQARRTPRYRRRLHQHVGPQILCREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHRAAVIFQDVGNLQLDRRRQRR GLDVT* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 14,378.198 | ||
Theoretical pI: | 11.611 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 79.288 | ||
aromaticity | 0.137 | ||
GRAVY | -0.868 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.214 | ||
sheet | 0.111 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333379.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
TSCTSMGPRPKLHQAHGAVCGGRAGDSRHPGKSRRPDDAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHDRESGALHVDAGDAGNEVSDGLERRSLENGDKPLSEV DQR* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 14,378.198 | ||
Theoretical pI: | 11.611 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 79.288 | ||
aromaticity | 0.137 | ||
GRAVY | -0.868 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.214 | ||
sheet | 0.111 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333379.1 | 5prime_partial | 117 | 801-448(-) |
Amino Acid sequence : | |||
VNYSIYNHHFADIRWNRFFTFLQNFYAFIVAPIMQYPHEHDCVSFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQFPNSRSVTAAHIHHRLHSVKRRRIVSYNGRRR* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 14,378.198 | ||
Theoretical pI: | 11.611 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 79.288 | ||
aromaticity | 0.137 | ||
GRAVY | -0.868 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.214 | ||
sheet | 0.111 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333379.1 | internal | 267 | 1-801(+) |
Amino Acid sequence : | |||
QLHAQAWDHALSYIKPTALSAAVELEIPDILENHGGPMTLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTTENLGPYMLMQATPVTRCPTGLSGEALKTGTSLYLK SIRGEDSWSDPAYGYHMKAFTNAMTAHARLTAAAIVRNYPAAFDGVQSVVDVGSRHGTAIGKLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDDK CIEILKKCKEAIPANIGKVMIVDAIIN | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 14,378.198 | ||
Theoretical pI: | 11.611 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 79.288 | ||
aromaticity | 0.137 | ||
GRAVY | -0.868 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.214 | ||
sheet | 0.111 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333379.1 | complete | 125 | 408-31(-) |
Amino Acid sequence : | |||
MVAVGRVTPRILTSDRLQIKACPRFQGFAAQARRTPRYRRRLHQHVGPQILCREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHRAAVIFQDVGNLQLDRRRQRR GLDVT* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 14,378.198 | ||
Theoretical pI: | 11.611 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 79.288 | ||
aromaticity | 0.137 | ||
GRAVY | -0.868 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.214 | ||
sheet | 0.111 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333379.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
TSCTSMGPRPKLHQAHGAVCGGRAGDSRHPGKSRRPDDAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHDRESGALHVDAGDAGNEVSDGLERRSLENGDKPLSEV DQR* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 14,378.198 | ||
Theoretical pI: | 11.611 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 79.288 | ||
aromaticity | 0.137 | ||
GRAVY | -0.868 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.214 | ||
sheet | 0.111 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333379.1 | 5prime_partial | 117 | 801-448(-) |
Amino Acid sequence : | |||
VNYSIYNHHFADIRWNRFFTFLQNFYAFIVAPIMQYPHEHDCVSFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQFPNSRSVTAAHIHHRLHSVKRRRIVSYNGRRR* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 14,378.198 | ||
Theoretical pI: | 11.611 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 79.288 | ||
aromaticity | 0.137 | ||
GRAVY | -0.868 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.214 | ||
sheet | 0.111 |