Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333381.1	5prime_partial	153	1-462(+)
Amino Acid sequence :
QNIIMETYRLFPAGPLLIPHLSSSHCRIGGYDIPEGTLVFVNAWAIQRDPQIWEDAGSFKPERFQGVETTQVYKLMPFGTGRRACPGTGLAQRMVGLALGSMIQCFEWERVSSKEIDLTE GDGLTMPMLNPLTAICKPRQIINKIVIHKDETA*
Physicochemical properties
Number of amino acids:		153
Molecular weight:		17,074.625
Theoretical pI:		6.338
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21220
Instability index:		34.692
aromaticity		0.078
GRAVY		-0.116
Secondary Structure Fraction
Helix		0.301
turn		0.235
sheet		0.248