| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333383.1 | complete | 177 | 22-555(+) |
Amino Acid sequence : | |||
| MSELVARTGRLQQRYEDGYRLIAGCIPFRYRTVKDDVSTNEKIVEVLMINSTGGPGLLFPKGGWENDETAEEAAEREAMEEAGVRGELVHFLGCYPFKSKTLQDEFSPEGLCRAAMYALQ VKEELDSWPEKSHRQRSWLTIPEAIGCCRHAWMREALEMGFSKWYADGMVHTNSSSC* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 20,106.544 | ||
| Theoretical pI: | 5.208 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36815 | ||
| Instability index: | 42.610 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.499 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.215 | ||
| sheet | 0.316 | ||