Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333383.1 | complete | 177 | 22-555(+) |
Amino Acid sequence : | |||
MSELVARTGRLQQRYEDGYRLIAGCIPFRYRTVKDDVSTNEKIVEVLMINSTGGPGLLFPKGGWENDETAEEAAEREAMEEAGVRGELVHFLGCYPFKSKTLQDEFSPEGLCRAAMYALQ VKEELDSWPEKSHRQRSWLTIPEAIGCCRHAWMREALEMGFSKWYADGMVHTNSSSC* | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 20,106.544 | ||
Theoretical pI: | 5.208 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36815 | ||
Instability index: | 42.610 | ||
aromaticity | 0.096 | ||
GRAVY | -0.499 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.215 | ||
sheet | 0.316 |