| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333384.1 | internal | 201 | 1-603(+) |
Amino Acid sequence : | |||
| ELGLYLDVSRAGFTDDWLREMEPRIQKAFHDMVELEKGAIANPDEGRMVGHYWLRNPKLAPKAILTQQIESTLDRICQFADQVISGKIRPPGKDKFTQILSIGIGGSALGPLFVAEALAP DNPPLKIRFIDNTDPAGIDHQIAQLGSELESTLVIVVSKSGGTPQTRNGLLEVQKAFREAGLEFAKQGVAITQENSLLDNT | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 21,987.815 | ||
| Theoretical pI: | 5.139 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 23.804 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.226 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.234 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333384.1 | internal | 201 | 1-603(+) |
Amino Acid sequence : | |||
| ELGLYLDVSRAGFTDDWLREMEPRIQKAFHDMVELEKGAIANPDEGRMVGHYWLRNPKLAPKAILTQQIESTLDRICQFADQVISGKIRPPGKDKFTQILSIGIGGSALGPLFVAEALAP DNPPLKIRFIDNTDPAGIDHQIAQLGSELESTLVIVVSKSGGTPQTRNGLLEVQKAFREAGLEFAKQGVAITQENSLLDNT | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 21,987.815 | ||
| Theoretical pI: | 5.139 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 23.804 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.226 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.234 | ||
| sheet | 0.279 | ||