| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333390.1 | 3prime_partial | 203 | 84-692(+) |
Amino Acid sequence : | |||
| MSWWWAGAIGAVKKKSDEDGAAVKHESVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNEDHPINYIQCDVSDSVDVEAKISPLTDITHVFYVTWTNRSTEAENCEANG KMLKNVLDIVIPNCPNLKHICLQTGKKHYLGPFQSLWKNEPHDPPFTEDLPRLDCPNFYYTLEDILLEEVKKKEGLTWSVHRP | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 22,801.693 | ||
| Theoretical pI: | 5.631 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 52940 53190 | ||
| Instability index: | 41.595 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.251 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333390.1 | 3prime_partial | 203 | 84-692(+) |
Amino Acid sequence : | |||
| MSWWWAGAIGAVKKKSDEDGAAVKHESVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPSWNEDHPINYIQCDVSDSVDVEAKISPLTDITHVFYVTWTNRSTEAENCEANG KMLKNVLDIVIPNCPNLKHICLQTGKKHYLGPFQSLWKNEPHDPPFTEDLPRLDCPNFYYTLEDILLEEVKKKEGLTWSVHRP | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 22,801.693 | ||
| Theoretical pI: | 5.631 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 52940 53190 | ||
| Instability index: | 41.595 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.251 | ||
| sheet | 0.222 | ||