| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333394.1 | internal | 258 | 3-776(+) |
Amino Acid sequence : | |||
| QRAFAGILQSVDELRYACENWQPLMSKVYFVLQVESLMSKIRNHGLDILELLKSSDECLPVELTPASLEQYVQKMKHVGSEQTSSIITNTIKDHVEGSAASAESLALVADSLGLKSNEEL LIEVVALEKLKENAEQADKSSEVDYIDQMMALVTHMHDLLVMVKQSETCNPVAIPPDFCCPLSLELMTDPVIVASGQTYERAYIRRWIDLGLTVCPKTRQTLAHTNLIPNYTVKALIANW CESNNVELPDPTKSINLK | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 28,773.786 | ||
| Theoretical pI: | 4.896 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27305 | ||
| Instability index: | 44.420 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.079 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.205 | ||
| sheet | 0.318 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333394.1 | internal | 258 | 3-776(+) |
Amino Acid sequence : | |||
| QRAFAGILQSVDELRYACENWQPLMSKVYFVLQVESLMSKIRNHGLDILELLKSSDECLPVELTPASLEQYVQKMKHVGSEQTSSIITNTIKDHVEGSAASAESLALVADSLGLKSNEEL LIEVVALEKLKENAEQADKSSEVDYIDQMMALVTHMHDLLVMVKQSETCNPVAIPPDFCCPLSLELMTDPVIVASGQTYERAYIRRWIDLGLTVCPKTRQTLAHTNLIPNYTVKALIANW CESNNVELPDPTKSINLK | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 28,773.786 | ||
| Theoretical pI: | 4.896 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27305 | ||
| Instability index: | 44.420 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.079 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.205 | ||
| sheet | 0.318 | ||