| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333406.1 | complete | 265 | 1-798(+) |
Amino Acid sequence : | |||
| MASTILRRLEGKVALITGAASGIGEAAARLFSRHGAKVVIADVQDDVARSICKDLGSTFVHCDVTKESDVEAAVNAAVKTHGTLDIMYNNAGIIESPQFKLLSDFPLSEFNRVVGVNLAG VFLGTKHAARVMIPKRRGSIISTATVASVLGGVGAHAYTASKHGVVGLMKNAAVELGRHGVRVNCVSPYIVATPMSRKFLESSDEGLTDFFYNLKGVELTAEDVAAAALYLASDESKYVS GLNLLVDGGFSVMNQGLNSFDSADS* | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 11,831.655 | ||
| Theoretical pI: | 8.473 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 62.649 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.284 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333406.1 | complete | 109 | 569-240(-) |
Amino Acid sequence : | |||
| MYGETQFTRTPCLPSSTAAFFISPTTPCFDAVYAWAPTPPSTLATVAVEMMLPRRLGIITLAACFVPRNTPARFTPTTRLNSDSGKSESSLNCGDSMMPALLYMMSRVP* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,831.655 | ||
| Theoretical pI: | 8.473 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 62.649 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.284 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333406.1 | complete | 265 | 1-798(+) |
Amino Acid sequence : | |||
| MASTILRRLEGKVALITGAASGIGEAAARLFSRHGAKVVIADVQDDVARSICKDLGSTFVHCDVTKESDVEAAVNAAVKTHGTLDIMYNNAGIIESPQFKLLSDFPLSEFNRVVGVNLAG VFLGTKHAARVMIPKRRGSIISTATVASVLGGVGAHAYTASKHGVVGLMKNAAVELGRHGVRVNCVSPYIVATPMSRKFLESSDEGLTDFFYNLKGVELTAEDVAAAALYLASDESKYVS GLNLLVDGGFSVMNQGLNSFDSADS* | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 11,831.655 | ||
| Theoretical pI: | 8.473 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 62.649 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.284 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333406.1 | complete | 109 | 569-240(-) |
Amino Acid sequence : | |||
| MYGETQFTRTPCLPSSTAAFFISPTTPCFDAVYAWAPTPPSTLATVAVEMMLPRRLGIITLAACFVPRNTPARFTPTTRLNSDSGKSESSLNCGDSMMPALLYMMSRVP* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,831.655 | ||
| Theoretical pI: | 8.473 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 62.649 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.284 | ||
| sheet | 0.275 | ||