Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333409.1 | 5prime_partial | 209 | 778-149(-) |
Amino Acid sequence : | |||
LKLMSSTFLVGLCQAIDLRHLEENLKISVKNSVSHVAKKILTTSQNTMLHPSRFCLKELLEVVDREHIFTYIDDPCSFNYPLMQKLRQVLVNHALANVEAEKELATSIFLKIGEFEEELK ALLPKEVEKVRAEFETKKASIENRIKNCRSYPLYRFVREVAGTDFLTGEKARSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGAPLPIC* | |||
Physicochemical properties | |||
Number of amino acids: | 209 | ||
Molecular weight: | 13,298.860 | ||
Theoretical pI: | 10.658 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 54.152 | ||
aromaticity | 0.115 | ||
GRAVY | -0.108 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.369 | ||
sheet | 0.213 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333409.1 | complete | 122 | 135-503(+) |
Amino Acid sequence : | |||
MIIFHQHIGRGAPFHSLRQSNNGSINFPSQIAVNTLSNSSPGERAFSPVKKSVPATSLTNLYKGYDLQFLILFSMEAFLVSNSARTFSTSLGRRAFNSSSNSPIFKKMEVANSFSASTFA NA* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,298.860 | ||
Theoretical pI: | 10.658 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 54.152 | ||
aromaticity | 0.115 | ||
GRAVY | -0.108 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.369 | ||
sheet | 0.213 |