| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333412.1 | 3prime_partial | 200 | 193-792(+) |
Amino Acid sequence : | |||
| MVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGK TQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRVVIGGLHGDAGL | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 21,856.731 | ||
| Theoretical pI: | 5.965 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 27.156 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.205 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333412.1 | 3prime_partial | 200 | 193-792(+) |
Amino Acid sequence : | |||
| MVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGK TQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRVVIGGLHGDAGL | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 21,856.731 | ||
| Theoretical pI: | 5.965 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 27.156 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.205 | ||
| sheet | 0.210 | ||