| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333413.1 | complete | 235 | 742-35(-) |
Amino Acid sequence : | |||
| MQATPVTRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFV GGDMFESLPKADAVMLMVLHDWSDDKCIEILKKCKEAIPTSTGKVMIVDAIINEEGEGDEFSGARLSLDMTMMAMTTQGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 25,624.193 | ||
| Theoretical pI: | 5.709 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 23.223 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.089 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.221 | ||
| sheet | 0.289 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333413.1 | complete | 235 | 742-35(-) |
Amino Acid sequence : | |||
| MQATPVTRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFV GGDMFESLPKADAVMLMVLHDWSDDKCIEILKKCKEAIPTSTGKVMIVDAIINEEGEGDEFSGARLSLDMTMMAMTTQGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 25,624.193 | ||
| Theoretical pI: | 5.709 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 23.223 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.089 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.221 | ||
| sheet | 0.289 | ||