| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333419.1 | internal | 255 | 2-766(+) |
Amino Acid sequence : | |||
| NIEKRNNDPKPDSLASKLPQKEGSIPCTDGKTSGEVHGSSSDGEKLLHKKCKSLAENTAEKSLKSADPVRRPVPVSERDREKRNGILGKSMDAWKEKRNWEDILAIPPRVSSRFSYSPGL NRKSAERGRVLHDKLMSPEKKKKSAPDLKKKAEEKHARATRIRAQLEHERVQRLQRTSEKLNRVSEWQTVRSNKLRESMFARHQRSESRHEAYIAQVVRRAGDETSKVNEVRFITSLNEE NKKHILRKKLHDSEL | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 29,347.913 | ||
| Theoretical pI: | 10.093 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 55.019 | ||
| aromaticity | 0.031 | ||
| GRAVY | -1.242 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.243 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333419.1 | internal | 255 | 2-766(+) |
Amino Acid sequence : | |||
| NIEKRNNDPKPDSLASKLPQKEGSIPCTDGKTSGEVHGSSSDGEKLLHKKCKSLAENTAEKSLKSADPVRRPVPVSERDREKRNGILGKSMDAWKEKRNWEDILAIPPRVSSRFSYSPGL NRKSAERGRVLHDKLMSPEKKKKSAPDLKKKAEEKHARATRIRAQLEHERVQRLQRTSEKLNRVSEWQTVRSNKLRESMFARHQRSESRHEAYIAQVVRRAGDETSKVNEVRFITSLNEE NKKHILRKKLHDSEL | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 29,347.913 | ||
| Theoretical pI: | 10.093 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 55.019 | ||
| aromaticity | 0.031 | ||
| GRAVY | -1.242 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.243 | ||
| sheet | 0.255 | ||