| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333420.1 | internal | 247 | 741-1(-) |
Amino Acid sequence : | |||
| SEWQTVRSNKLRESMFARHQRSESRHEAYIAQVVRRAGDETSKVNEVRFITSLNEENKKHILRKKLHDSELRRAEKLQVIKTKQKEDMAREEAVLERKRLIEAEKLQRLAETQRRKEEAQ VRREEERKASSAAREAKAMEQMRRKEIRAKAQQEEAELLAQKLAEKLRESYQRRKFYLEQIRERASMDFRDQSSPLLRRFASKEGQTQAQVRLAPYNNGDDNPTNDGSCASGTGISEALQ HSLKRRI | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 29,100.475 | ||
| Theoretical pI: | 9.984 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 71.482 | ||
| aromaticity | 0.040 | ||
| GRAVY | -1.246 | ||
Secondary Structure Fraction | |||
| Helix | 0.194 | ||
| turn | 0.146 | ||
| sheet | 0.344 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333420.1 | internal | 247 | 741-1(-) |
Amino Acid sequence : | |||
| SEWQTVRSNKLRESMFARHQRSESRHEAYIAQVVRRAGDETSKVNEVRFITSLNEENKKHILRKKLHDSELRRAEKLQVIKTKQKEDMAREEAVLERKRLIEAEKLQRLAETQRRKEEAQ VRREEERKASSAAREAKAMEQMRRKEIRAKAQQEEAELLAQKLAEKLRESYQRRKFYLEQIRERASMDFRDQSSPLLRRFASKEGQTQAQVRLAPYNNGDDNPTNDGSCASGTGISEALQ HSLKRRI | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 29,100.475 | ||
| Theoretical pI: | 9.984 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 71.482 | ||
| aromaticity | 0.040 | ||
| GRAVY | -1.246 | ||
Secondary Structure Fraction | |||
| Helix | 0.194 | ||
| turn | 0.146 | ||
| sheet | 0.344 | ||