Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333424.1 | 5prime_partial | 220 | 1-663(+) |
Amino Acid sequence : | |||
AQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIHSIINMDA DVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYGEVKPALENMVAAAKLLRTQLASAK* | |||
Physicochemical properties | |||
Number of amino acids: | 220 | ||
Molecular weight: | 11,190.984 | ||
Theoretical pI: | 9.298 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 62.136 | ||
aromaticity | 0.110 | ||
GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.300 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333424.1 | complete | 100 | 614-312(-) |
Amino Acid sequence : | |||
MFSRAGFTSPYLRVLRPQSGFTHKMLVSRTASILLILSAISSVDGILGEWMSYTPGPIPAPYFTPSRKTDSSFSSEREFSIVITSASMLMMEWMMSLKLE* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,190.984 | ||
Theoretical pI: | 9.298 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 62.136 | ||
aromaticity | 0.110 | ||
GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.300 | ||
sheet | 0.280 |