| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333451.1 | 5prime_partial | 234 | 3-707(+) |
Amino Acid sequence : | |||
| KNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPT KVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGKIPDKDILALIKENFDFRPGMIAINLDLKRGGNFRYQKTAAYGHFGRDDPDFTWETVKVLKPKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 12,221.811 | ||
| Theoretical pI: | 4.432 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 45.275 | ||
| aromaticity | 0.046 | ||
| GRAVY | 0.126 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.220 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333451.1 | 3prime_partial | 109 | 329-3(-) |
Amino Acid sequence : | |||
| MSTPATICVDNDLPTSETGISMWTTNHETPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVL | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,221.811 | ||
| Theoretical pI: | 4.432 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 45.275 | ||
| aromaticity | 0.046 | ||
| GRAVY | 0.126 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.220 | ||
| sheet | 0.239 | ||