Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333451.1 | 5prime_partial | 234 | 3-707(+) |
Amino Acid sequence : | |||
KNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPT KVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGKIPDKDILALIKENFDFRPGMIAINLDLKRGGNFRYQKTAAYGHFGRDDPDFTWETVKVLKPKA* | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 12,221.811 | ||
Theoretical pI: | 4.432 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 45.275 | ||
aromaticity | 0.046 | ||
GRAVY | 0.126 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.220 | ||
sheet | 0.239 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333451.1 | 3prime_partial | 109 | 329-3(-) |
Amino Acid sequence : | |||
MSTPATICVDNDLPTSETGISMWTTNHETPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVL | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,221.811 | ||
Theoretical pI: | 4.432 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 45.275 | ||
aromaticity | 0.046 | ||
GRAVY | 0.126 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.220 | ||
sheet | 0.239 |