| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333453.1 | internal | 261 | 2-784(+) |
Amino Acid sequence : | |||
| DNNFHSLTTQKPTTMSTLCVPAHVPSAAQDSEQLHKAFSGWGTNEDLIISILGRRNASQRKLIRQCYAETYGEDLLKALDKELSSDFERLVLIWTLDPSERDAYLANEATKRWTSSNKVL VEIACTRSPKELLLAREAYHARFKKSLEEDVAYHTTGDFRKLLVALVSSYRYCGDDVNLHLAKSEAKILHEKITAKEYSCDEVIRILTTRSKAQINATLNQYKNAFGNDINKDXEADPED EFLALLRATVKCLIFPEKHFS | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 29,544.087 | ||
| Theoretical pI: | 6.281 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30285 | ||
| Instability index: | 43.569 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.454 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.177 | ||
| sheet | 0.300 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333453.1 | internal | 261 | 2-784(+) |
Amino Acid sequence : | |||
| DNNFHSLTTQKPTTMSTLCVPAHVPSAAQDSEQLHKAFSGWGTNEDLIISILGRRNASQRKLIRQCYAETYGEDLLKALDKELSSDFERLVLIWTLDPSERDAYLANEATKRWTSSNKVL VEIACTRSPKELLLAREAYHARFKKSLEEDVAYHTTGDFRKLLVALVSSYRYCGDDVNLHLAKSEAKILHEKITAKEYSCDEVIRILTTRSKAQINATLNQYKNAFGNDINKDXEADPED EFLALLRATVKCLIFPEKHFS | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 29,544.087 | ||
| Theoretical pI: | 6.281 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30285 | ||
| Instability index: | 43.569 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.454 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.177 | ||
| sheet | 0.300 | ||