Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333453.1 | internal | 261 | 2-784(+) |
Amino Acid sequence : | |||
DNNFHSLTTQKPTTMSTLCVPAHVPSAAQDSEQLHKAFSGWGTNEDLIISILGRRNASQRKLIRQCYAETYGEDLLKALDKELSSDFERLVLIWTLDPSERDAYLANEATKRWTSSNKVL VEIACTRSPKELLLAREAYHARFKKSLEEDVAYHTTGDFRKLLVALVSSYRYCGDDVNLHLAKSEAKILHEKITAKEYSCDEVIRILTTRSKAQINATLNQYKNAFGNDINKDXEADPED EFLALLRATVKCLIFPEKHFS | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 29,544.087 | ||
Theoretical pI: | 6.281 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30285 | ||
Instability index: | 43.569 | ||
aromaticity | 0.081 | ||
GRAVY | -0.454 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.177 | ||
sheet | 0.300 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333453.1 | internal | 261 | 2-784(+) |
Amino Acid sequence : | |||
DNNFHSLTTQKPTTMSTLCVPAHVPSAAQDSEQLHKAFSGWGTNEDLIISILGRRNASQRKLIRQCYAETYGEDLLKALDKELSSDFERLVLIWTLDPSERDAYLANEATKRWTSSNKVL VEIACTRSPKELLLAREAYHARFKKSLEEDVAYHTTGDFRKLLVALVSSYRYCGDDVNLHLAKSEAKILHEKITAKEYSCDEVIRILTTRSKAQINATLNQYKNAFGNDINKDXEADPED EFLALLRATVKCLIFPEKHFS | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 29,544.087 | ||
Theoretical pI: | 6.281 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30285 | ||
Instability index: | 43.569 | ||
aromaticity | 0.081 | ||
GRAVY | -0.454 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.177 | ||
sheet | 0.300 |