| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333455.1 | 3prime_partial | 174 | 90-611(+) |
Amino Acid sequence : | |||
| MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSXEGLYEGLDWLS | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 15,427.442 | ||
| Theoretical pI: | 8.737 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
| Instability index: | 20.530 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.235 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333455.1 | complete | 136 | 413-3(-) |
Amino Acid sequence : | |||
| MQLIPSLHNTIPIIAIYHKYETLRVLEVVPPQWTNLVLTSDIPYSEANVLVFNSLHVETDGGNGGDNFSQLELVQDGGLTSSIKTNHQNTHLLLGKKPAKQLCERQPHFRKTIDLAKWWR VWAEKYGAASKGRDRL* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 15,427.442 | ||
| Theoretical pI: | 8.737 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
| Instability index: | 20.530 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.235 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333455.1 | 3prime_partial | 174 | 90-611(+) |
Amino Acid sequence : | |||
| MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSXEGLYEGLDWLS | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 15,427.442 | ||
| Theoretical pI: | 8.737 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
| Instability index: | 20.530 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.235 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333455.1 | complete | 136 | 413-3(-) |
Amino Acid sequence : | |||
| MQLIPSLHNTIPIIAIYHKYETLRVLEVVPPQWTNLVLTSDIPYSEANVLVFNSLHVETDGGNGGDNFSQLELVQDGGLTSSIKTNHQNTHLLLGKKPAKQLCERQPHFRKTIDLAKWWR VWAEKYGAASKGRDRL* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 15,427.442 | ||
| Theoretical pI: | 8.737 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
| Instability index: | 20.530 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.235 | ||
| sheet | 0.235 | ||