Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333473.1 | internal | 281 | 3-845(+) |
Amino Acid sequence : | |||
EREREMDVSILRDVRPPVTSYAPNIWADTFSNISLDEEVQKKYAETIEALKQVVRGMLMAAATPIKQMIFIDTLERLGLAYHFETEIEHKLQKIYDDDVCGDDCDLFTTALRFRLLRQHR HHVSCDVFDKFLYEEGKFKGDAEGLLSLYEASHVRFHNEKILEEAERFTRQELSCMESKLQSPLKDKVKRALVRPLHREVPILYARHFISIYEKDESMDEHLLKLAKFNFNFLQNLYKKE LYDLSRWWNKFDLKNKLPYIRDRLAEAYLWGVGYHFEPQYS | |||
Physicochemical properties | |||
Number of amino acids: | 281 | ||
Molecular weight: | 33,523.956 | ||
Theoretical pI: | 6.040 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42860 43110 | ||
Instability index: | 51.397 | ||
aromaticity | 0.121 | ||
GRAVY | -0.525 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.139 | ||
sheet | 0.302 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333473.1 | internal | 281 | 3-845(+) |
Amino Acid sequence : | |||
EREREMDVSILRDVRPPVTSYAPNIWADTFSNISLDEEVQKKYAETIEALKQVVRGMLMAAATPIKQMIFIDTLERLGLAYHFETEIEHKLQKIYDDDVCGDDCDLFTTALRFRLLRQHR HHVSCDVFDKFLYEEGKFKGDAEGLLSLYEASHVRFHNEKILEEAERFTRQELSCMESKLQSPLKDKVKRALVRPLHREVPILYARHFISIYEKDESMDEHLLKLAKFNFNFLQNLYKKE LYDLSRWWNKFDLKNKLPYIRDRLAEAYLWGVGYHFEPQYS | |||
Physicochemical properties | |||
Number of amino acids: | 281 | ||
Molecular weight: | 33,523.956 | ||
Theoretical pI: | 6.040 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42860 43110 | ||
Instability index: | 51.397 | ||
aromaticity | 0.121 | ||
GRAVY | -0.525 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.139 | ||
sheet | 0.302 |