| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333475.1 | 3prime_partial | 253 | 38-796(+) |
Amino Acid sequence : | |||
| MDSFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFISPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGA GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGXFVI GGPHGDAGLTGRK | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 11,340.829 | ||
| Theoretical pI: | 4.768 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 47.202 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.370 | ||
| turn | 0.230 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333475.1 | 5prime_partial | 101 | 796-491(-) |
Amino Acid sequence : | |||
| LPTSETGISMWTTNHEXPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,340.829 | ||
| Theoretical pI: | 4.768 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 47.202 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.370 | ||
| turn | 0.230 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333475.1 | 3prime_partial | 253 | 38-796(+) |
Amino Acid sequence : | |||
| MDSFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFISPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGA GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGXFVI GGPHGDAGLTGRK | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 11,340.829 | ||
| Theoretical pI: | 4.768 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 47.202 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.370 | ||
| turn | 0.230 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333475.1 | 5prime_partial | 101 | 796-491(-) |
Amino Acid sequence : | |||
| LPTSETGISMWTTNHEXPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,340.829 | ||
| Theoretical pI: | 4.768 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 47.202 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.370 | ||
| turn | 0.230 | ||
| sheet | 0.240 | ||