| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333485.1 | internal | 221 | 2-664(+) |
Amino Acid sequence : | |||
| KGVILTHRSLITSIAQQVDGENPNLYLKAEDVVLCVLPLFHIYSLNSVLLCSLRAGAGVLLMQKFEIGSLLELIQKHRVSVAAVVPPLVLALAKNPLVDNFDLSSIRVVLSGAAPLGKEL EAALLSRLPQAIFGQGYGMTEAGPVLSMSPSFAKQPLPTKSGSCGNVVRNAELKVIDPETGCSLPRTQPGEICIRGPQIMKGYLNDAEATARTIDVDGWLH | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 10,024.793 | ||
| Theoretical pI: | 5.063 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 43.477 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.313 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333485.1 | 5prime_partial | 180 | 663-121(-) |
Amino Acid sequence : | |||
| CSQPSTSMVLAVASASFKYPFMIWGPRMQISPGWVRGREQPVSGSMTLSSALRTTLPHEPDLVGSGCFANDGDIDSTGPASVMPYPCPKMACGRRLSRAASSSLPSGAAPDNTTLMELKS KLSTKGFLASASTSGGTTAATDTRCFCISSNSDPISNFCINRTPAPALSEHSNTEFNEYM* | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 10,024.793 | ||
| Theoretical pI: | 5.063 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 43.477 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.313 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333485.1 | 5prime_partial | 99 | 1-300(+) |
Amino Acid sequence : | |||
| ERCDSDTQEPHHEHRPTGGRREPQFIPEGGGRGVVRAAFVSHILVEFGVAVLAESGGGGSVDAEIRDWIAVGADTEAPRVGGSGGAAAGAGAGQEPLGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,024.793 | ||
| Theoretical pI: | 5.063 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 43.477 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.313 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333485.1 | internal | 221 | 2-664(+) |
Amino Acid sequence : | |||
| KGVILTHRSLITSIAQQVDGENPNLYLKAEDVVLCVLPLFHIYSLNSVLLCSLRAGAGVLLMQKFEIGSLLELIQKHRVSVAAVVPPLVLALAKNPLVDNFDLSSIRVVLSGAAPLGKEL EAALLSRLPQAIFGQGYGMTEAGPVLSMSPSFAKQPLPTKSGSCGNVVRNAELKVIDPETGCSLPRTQPGEICIRGPQIMKGYLNDAEATARTIDVDGWLH | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 10,024.793 | ||
| Theoretical pI: | 5.063 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 43.477 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.313 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333485.1 | 5prime_partial | 180 | 663-121(-) |
Amino Acid sequence : | |||
| CSQPSTSMVLAVASASFKYPFMIWGPRMQISPGWVRGREQPVSGSMTLSSALRTTLPHEPDLVGSGCFANDGDIDSTGPASVMPYPCPKMACGRRLSRAASSSLPSGAAPDNTTLMELKS KLSTKGFLASASTSGGTTAATDTRCFCISSNSDPISNFCINRTPAPALSEHSNTEFNEYM* | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 10,024.793 | ||
| Theoretical pI: | 5.063 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 43.477 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.313 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333485.1 | 5prime_partial | 99 | 1-300(+) |
Amino Acid sequence : | |||
| ERCDSDTQEPHHEHRPTGGRREPQFIPEGGGRGVVRAAFVSHILVEFGVAVLAESGGGGSVDAEIRDWIAVGADTEAPRVGGSGGAAAGAGAGQEPLGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,024.793 | ||
| Theoretical pI: | 5.063 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 43.477 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.313 | ||
| sheet | 0.263 | ||