| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333489.1 | internal | 273 | 2-820(+) |
Amino Acid sequence : | |||
| LLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQ EYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTK SQFDNLYGCRHSLPDGLMRATDVMIAEKWELCV | |||
Physicochemical properties | |||
| Number of amino acids: | 273 | ||
| Molecular weight: | 28,400.818 | ||
| Theoretical pI: | 5.595 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 45.703 | ||
| aromaticity | 0.015 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.283 | ||
| sheet | 0.316 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333489.1 | 5prime_partial | 272 | 820-2(-) |
Amino Acid sequence : | |||
| HTQLPLFGNHHISSPHKSIRQRVPATIQVIELALGDRIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIISRAGVRQLPRLLVLLLRLHAL VDQQSGITAVVHDEIGAAARAPIEGPLGAPPVLLQGLTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHLGELD FEAAEVGLGHVLDLVLAAGGGLLHLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 28,400.818 | ||
| Theoretical pI: | 5.595 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 45.703 | ||
| aromaticity | 0.015 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.283 | ||
| sheet | 0.316 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333489.1 | internal | 273 | 2-820(+) |
Amino Acid sequence : | |||
| LLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQ EYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTK SQFDNLYGCRHSLPDGLMRATDVMIAEKWELCV | |||
Physicochemical properties | |||
| Number of amino acids: | 273 | ||
| Molecular weight: | 28,400.818 | ||
| Theoretical pI: | 5.595 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 45.703 | ||
| aromaticity | 0.015 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.283 | ||
| sheet | 0.316 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333489.1 | 5prime_partial | 272 | 820-2(-) |
Amino Acid sequence : | |||
| HTQLPLFGNHHISSPHKSIRQRVPATIQVIELALGDRIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIISRAGVRQLPRLLVLLLRLHAL VDQQSGITAVVHDEIGAAARAPIEGPLGAPPVLLQGLTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHLGELD FEAAEVGLGHVLDLVLAAGGGLLHLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 28,400.818 | ||
| Theoretical pI: | 5.595 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 45.703 | ||
| aromaticity | 0.015 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.283 | ||
| sheet | 0.316 | ||