| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333495.1 | internal | 275 | 2-826(+) |
Amino Acid sequence : | |||
| SVSARAGGIFLPLVKSLCVACGSNAGDGTEHKLGSWLMLTCFQTSVISSSMFLTAMAANPLAANLTASTINMSIGWMDWAKAAIVPGLVSLIVVPLLLYIIYPPSVKSSPDAPKLAREKL EKMGPLSKSEIIMAGTLLLTVGLWIFGGVLKVDAVTAAILGLSVLLATGVVTWKECLAESVAWDTLTWFAALIAMAGYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYF FASGAAHIGAMFTAFLSVASALGTPPYLGAVVLSF | |||
Physicochemical properties | |||
| Number of amino acids: | 275 | ||
| Molecular weight: | 13,778.567 | ||
| Theoretical pI: | 10.154 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 51.241 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.178 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.307 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333495.1 | complete | 127 | 687-304(-) |
Amino Acid sequence : | |||
| MPKDSCHERPNPPTNLTTVWLNQEMRPYLLRYPAIAISAANHVSVSQATDSARHSFHVTTPVARRTDKPRIAAVTASTFSTPPKIQSPTVRSRVPAMMISLLDNGPIFSNFSLASFGASG LLFTEGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,778.567 | ||
| Theoretical pI: | 10.154 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 51.241 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.178 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.307 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333495.1 | internal | 275 | 2-826(+) |
Amino Acid sequence : | |||
| SVSARAGGIFLPLVKSLCVACGSNAGDGTEHKLGSWLMLTCFQTSVISSSMFLTAMAANPLAANLTASTINMSIGWMDWAKAAIVPGLVSLIVVPLLLYIIYPPSVKSSPDAPKLAREKL EKMGPLSKSEIIMAGTLLLTVGLWIFGGVLKVDAVTAAILGLSVLLATGVVTWKECLAESVAWDTLTWFAALIAMAGYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYF FASGAAHIGAMFTAFLSVASALGTPPYLGAVVLSF | |||
Physicochemical properties | |||
| Number of amino acids: | 275 | ||
| Molecular weight: | 13,778.567 | ||
| Theoretical pI: | 10.154 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 51.241 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.178 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.307 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333495.1 | complete | 127 | 687-304(-) |
Amino Acid sequence : | |||
| MPKDSCHERPNPPTNLTTVWLNQEMRPYLLRYPAIAISAANHVSVSQATDSARHSFHVTTPVARRTDKPRIAAVTASTFSTPPKIQSPTVRSRVPAMMISLLDNGPIFSNFSLASFGASG LLFTEGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,778.567 | ||
| Theoretical pI: | 10.154 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 51.241 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.178 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.307 | ||
| sheet | 0.228 | ||