| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333499.1 | 5prime_partial | 145 | 2-439(+) |
Amino Acid sequence : | |||
| LRLHSPIPLLVPHMNQEEATLGGYTIPKESKVVVNAWWLSNNPEWWKNPEEFRPERFMEEDSGTEAAVAGGKVDFRFLPFGMGRRSCPGIILALPILGLIIARLVSNFEIMPPAGLREVD VSEKGGQFSLHIANHSTIVFKPIEA* | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 12,649.597 | ||
| Theoretical pI: | 10.429 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 31.875 | ||
| aromaticity | 0.059 | ||
| GRAVY | 0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.361 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333499.1 | complete | 119 | 429-70(-) |
Amino Acid sequence : | |||
| MGLKTIVEWLAMCRLNCPPFSLTSTSLNPAGGIISKFETSLAMIRPRMGSARIIPGQLLLPIPNGKNLKSTLPPATAASVPLSSSMNRSGRNSSGFFHHSGLLDSHHAFTTTLDSFGIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,649.597 | ||
| Theoretical pI: | 10.429 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 31.875 | ||
| aromaticity | 0.059 | ||
| GRAVY | 0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.361 | ||
| sheet | 0.252 | ||