Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333499.1 | 5prime_partial | 145 | 2-439(+) |
Amino Acid sequence : | |||
LRLHSPIPLLVPHMNQEEATLGGYTIPKESKVVVNAWWLSNNPEWWKNPEEFRPERFMEEDSGTEAAVAGGKVDFRFLPFGMGRRSCPGIILALPILGLIIARLVSNFEIMPPAGLREVD VSEKGGQFSLHIANHSTIVFKPIEA* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 12,649.597 | ||
Theoretical pI: | 10.429 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 31.875 | ||
aromaticity | 0.059 | ||
GRAVY | 0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.361 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333499.1 | complete | 119 | 429-70(-) |
Amino Acid sequence : | |||
MGLKTIVEWLAMCRLNCPPFSLTSTSLNPAGGIISKFETSLAMIRPRMGSARIIPGQLLLPIPNGKNLKSTLPPATAASVPLSSSMNRSGRNSSGFFHHSGLLDSHHAFTTTLDSFGIV* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 12,649.597 | ||
Theoretical pI: | 10.429 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 31.875 | ||
aromaticity | 0.059 | ||
GRAVY | 0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.361 | ||
sheet | 0.252 |