Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333501.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
LFLSRCSHFLLERSKKMAEEKPKSAGVWPTVKPFVNGGASGMLATCVIQPIDMIKVRIQLGQGSAGVVTKNMLKNEGIGAFYKGLSAGLLRQATYTTARLGSFRILTNKAVEANDGKPLP LYQKALCGLTAGAIGACVGSPADLALIRMQADATLPAAQRRNYTNAFHALYRITADEGVLALWKGAGPTVVRAMALNMGMLASYDQSVEFCRDSLGFGEAATVVGASTVSGFFAAACSLP FDYVK | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 25,906.888 | ||
Theoretical pI: | 9.444 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21805 | ||
Instability index: | 28.274 | ||
aromaticity | 0.082 | ||
GRAVY | 0.200 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.237 | ||
sheet | 0.314 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333501.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
LFLSRCSHFLLERSKKMAEEKPKSAGVWPTVKPFVNGGASGMLATCVIQPIDMIKVRIQLGQGSAGVVTKNMLKNEGIGAFYKGLSAGLLRQATYTTARLGSFRILTNKAVEANDGKPLP LYQKALCGLTAGAIGACVGSPADLALIRMQADATLPAAQRRNYTNAFHALYRITADEGVLALWKGAGPTVVRAMALNMGMLASYDQSVEFCRDSLGFGEAATVVGASTVSGFFAAACSLP FDYVK | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 25,906.888 | ||
Theoretical pI: | 9.444 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21805 | ||
Instability index: | 28.274 | ||
aromaticity | 0.082 | ||
GRAVY | 0.200 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.237 | ||
sheet | 0.314 |