| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333508.1 | internal | 266 | 3-800(+) |
Amino Acid sequence : | |||
| EASTPAKRRREPITISLKKVCKVCKKPGHEAGFRGATYIDCPMKPCFLCKMPGHTTMACPHRVATEFGVSPAPFKSSHSSLEYVFERQLRCRVPAIKPAFVIPNKVNCAVIRYHSRRVTC LEFHPTKNNILISGDKKGQLGVWDYGKVHERIVYGNVHGCILNNMKFNPSNDGTIYGASSDGTVSSTDLETGISLSLVNLNPNGWQGPKTWRMLYGLDMNTDKRVLLAADNFGLLYMIDA RSNEVTGKPILIHKRGSKVTGLHCHP | |||
Physicochemical properties | |||
| Number of amino acids: | 266 | ||
| Molecular weight: | 29,523.953 | ||
| Theoretical pI: | 9.538 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 29045 | ||
| Instability index: | 36.368 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.315 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.274 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333508.1 | internal | 266 | 3-800(+) |
Amino Acid sequence : | |||
| EASTPAKRRREPITISLKKVCKVCKKPGHEAGFRGATYIDCPMKPCFLCKMPGHTTMACPHRVATEFGVSPAPFKSSHSSLEYVFERQLRCRVPAIKPAFVIPNKVNCAVIRYHSRRVTC LEFHPTKNNILISGDKKGQLGVWDYGKVHERIVYGNVHGCILNNMKFNPSNDGTIYGASSDGTVSSTDLETGISLSLVNLNPNGWQGPKTWRMLYGLDMNTDKRVLLAADNFGLLYMIDA RSNEVTGKPILIHKRGSKVTGLHCHP | |||
Physicochemical properties | |||
| Number of amino acids: | 266 | ||
| Molecular weight: | 29,523.953 | ||
| Theoretical pI: | 9.538 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 29045 | ||
| Instability index: | 36.368 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.315 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.274 | ||
| sheet | 0.192 | ||