Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333545.1 | 3prime_partial | 147 | 411-851(+) |
Amino Acid sequence : | |||
MGRKASHVALECTLQSHPNMVVLAEEVDASKLTLFDITKQLCDAVQARAERGKYHGVVLLPEGLIESIPEVYALLQEIHGLLRQGVSTDNIYDQLSPWASALFEFLPPFIRKQLLLHPES DDSAQLSQIETEKLLAHLTETEMNKRL | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 16,501.762 | ||
Theoretical pI: | 5.161 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 66.393 | ||
aromaticity | 0.054 | ||
GRAVY | -0.111 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.177 | ||
sheet | 0.361 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333545.1 | 3prime_partial | 147 | 411-851(+) |
Amino Acid sequence : | |||
MGRKASHVALECTLQSHPNMVVLAEEVDASKLTLFDITKQLCDAVQARAERGKYHGVVLLPEGLIESIPEVYALLQEIHGLLRQGVSTDNIYDQLSPWASALFEFLPPFIRKQLLLHPES DDSAQLSQIETEKLLAHLTETEMNKRL | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 16,501.762 | ||
Theoretical pI: | 5.161 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 66.393 | ||
aromaticity | 0.054 | ||
GRAVY | -0.111 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.177 | ||
sheet | 0.361 |