| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333545.1 | 3prime_partial | 147 | 411-851(+) |
Amino Acid sequence : | |||
| MGRKASHVALECTLQSHPNMVVLAEEVDASKLTLFDITKQLCDAVQARAERGKYHGVVLLPEGLIESIPEVYALLQEIHGLLRQGVSTDNIYDQLSPWASALFEFLPPFIRKQLLLHPES DDSAQLSQIETEKLLAHLTETEMNKRL | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 16,501.762 | ||
| Theoretical pI: | 5.161 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 66.393 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.177 | ||
| sheet | 0.361 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333545.1 | 3prime_partial | 147 | 411-851(+) |
Amino Acid sequence : | |||
| MGRKASHVALECTLQSHPNMVVLAEEVDASKLTLFDITKQLCDAVQARAERGKYHGVVLLPEGLIESIPEVYALLQEIHGLLRQGVSTDNIYDQLSPWASALFEFLPPFIRKQLLLHPES DDSAQLSQIETEKLLAHLTETEMNKRL | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 16,501.762 | ||
| Theoretical pI: | 5.161 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 66.393 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.177 | ||
| sheet | 0.361 | ||