Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333552.1 | 5prime_partial | 218 | 3-659(+) |
Amino Acid sequence : | |||
ERKKMSATEIQVESVVFPPAVKPPGSDKMLFLGGAGVRGMEMEGKFIKFTAIGVYLEDSSVAVLAAKWKGKTADELADSDEFVREVITGPFEKLTKVTTILPLTGQQYSEKVAENCTAYW KAVGKYTEAEGEAIAKFLQIFKDETFPPGASILFTQSASGSLTIAFSDDGSVPEQGKAVINNKLLAEAILESIIGRHGVSPTARRSLAARVSELMKLK* | |||
Physicochemical properties | |||
Number of amino acids: | 218 | ||
Molecular weight: | 23,508.779 | ||
Theoretical pI: | 6.053 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 39.674 | ||
aromaticity | 0.078 | ||
GRAVY | -0.070 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.220 | ||
sheet | 0.303 |