| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333556.1 | 5prime_partial | 190 | 3-575(+) |
Amino Acid sequence : | |||
| AVFPSLQGGPHNHQIGALAVALKQALSPGFKAYAKQVKANAVALGNYLMSKGYSLVTGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNAVFGDSSALAPGGVRIGAPAMTSRGLV EKDFEQIAEFLHRAVSLTLKIQKEHGKLLKDFNKGLVNNKEIEELKADVEKFSASFDMPGFLVSEMKYKD* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 20,526.499 | ||
| Theoretical pI: | 8.991 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 40.900 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.097 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.247 | ||
| sheet | 0.305 | ||