Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333556.1 | 5prime_partial | 190 | 3-575(+) |
Amino Acid sequence : | |||
AVFPSLQGGPHNHQIGALAVALKQALSPGFKAYAKQVKANAVALGNYLMSKGYSLVTGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNAVFGDSSALAPGGVRIGAPAMTSRGLV EKDFEQIAEFLHRAVSLTLKIQKEHGKLLKDFNKGLVNNKEIEELKADVEKFSASFDMPGFLVSEMKYKD* | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 20,526.499 | ||
Theoretical pI: | 8.991 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 40.900 | ||
aromaticity | 0.074 | ||
GRAVY | -0.097 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.247 | ||
sheet | 0.305 |