| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333557.1 | 5prime_partial | 236 | 2-712(+) |
Amino Acid sequence : | |||
| SPAYYTCSLHQTLEPSCSPSSSATFYRRPISPKVSSFYGARILVSGRVNQVPTFLLRQLRRNSRPTCRPGIKAVATPDSAVELPLTAENVESVLDEIRPYLIADGGNVALHEIDGNVVRL KLQGACGSCPSATMTMKMGIERRLMEKIPEVVAVESIPDEETGLELNEENIEKVLEEIRPYLVGAAGGDLELVEIEEPIVKVRITGPAAGVMTVRVAVTQKLREKIPFIAAVQLLS* | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 25,696.426 | ||
| Theoretical pI: | 5.612 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
| Instability index: | 64.256 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.015 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.246 | ||
| sheet | 0.297 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333557.1 | 5prime_partial | 236 | 2-712(+) |
Amino Acid sequence : | |||
| SPAYYTCSLHQTLEPSCSPSSSATFYRRPISPKVSSFYGARILVSGRVNQVPTFLLRQLRRNSRPTCRPGIKAVATPDSAVELPLTAENVESVLDEIRPYLIADGGNVALHEIDGNVVRL KLQGACGSCPSATMTMKMGIERRLMEKIPEVVAVESIPDEETGLELNEENIEKVLEEIRPYLVGAAGGDLELVEIEEPIVKVRITGPAAGVMTVRVAVTQKLREKIPFIAAVQLLS* | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 25,696.426 | ||
| Theoretical pI: | 5.612 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
| Instability index: | 64.256 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.015 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.246 | ||
| sheet | 0.297 | ||