| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333565.1 | internal | 259 | 2-778(+) |
Amino Acid sequence : | |||
| RMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAE NGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLHQLPYLQATINETLRLHSPIPLLVPHMNXEEATLGGYT IPKESKVVVNAWWLSHNPE | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 14,000.089 | ||
| Theoretical pI: | 5.850 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 42.666 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.050 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.192 | ||
| sheet | 0.288 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333565.1 | 3prime_partial | 125 | 376-2(-) |
Amino Acid sequence : | |||
| MLFAVFSHDFPSLLDIIIVEKCEPSALQVSAFSKVALQERPEQGDEIAVVVIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHL LLPHP | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,000.089 | ||
| Theoretical pI: | 5.850 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 42.666 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.050 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.192 | ||
| sheet | 0.288 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333565.1 | internal | 259 | 2-778(+) |
Amino Acid sequence : | |||
| RMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAE NGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLHQLPYLQATINETLRLHSPIPLLVPHMNXEEATLGGYT IPKESKVVVNAWWLSHNPE | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 14,000.089 | ||
| Theoretical pI: | 5.850 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 42.666 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.050 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.192 | ||
| sheet | 0.288 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333565.1 | 3prime_partial | 125 | 376-2(-) |
Amino Acid sequence : | |||
| MLFAVFSHDFPSLLDIIIVEKCEPSALQVSAFSKVALQERPEQGDEIAVVVIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHL LLPHP | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,000.089 | ||
| Theoretical pI: | 5.850 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 42.666 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.050 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.192 | ||
| sheet | 0.288 | ||