Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333572.1 | complete | 247 | 52-795(+) |
Amino Acid sequence : | |||
MTQTESAILAHARRCAPAESCGFVVSTPEGERYFPCVNISGEPEAYFRMSPEDWLQAEMQGEIVALVHSHPGGLPWLSEADRRLQVQSDLPWWLVCRGTIHKFRCVPHLTGRRFEHGVTD CYTLFRDAYHLAGIEMPDFHREDDWWRNGQNLYLDNLEATGLYQVPLSAAQPGDVLLCCFGSSVPNHAAIYCGDGELLHHIPEQLSKRERYTDKWQRRTHSLWRHRAWRASAFTGIYNDL VAASTFV* | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 12,892.181 | ||
Theoretical pI: | 9.257 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 76.805 | ||
aromaticity | 0.025 | ||
GRAVY | -0.788 | ||
Secondary Structure Fraction | |||
Helix | 0.124 | ||
turn | 0.306 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333572.1 | complete | 134 | 471-67(-) |
Amino Acid sequence : | |||
MKVRHLNPRQMISIPEQCVTVRHTVLKAPPGEMRHTAELMNRPPADQPPRQITLHLQPPVGLTQPGQTTGVAVDQRHNLTLHFCLQPVFRRHTEIRLRLTGDIHAGEISFPLRRAYHEAA RLRWRTSPGVRQNR* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 12,892.181 | ||
Theoretical pI: | 9.257 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 76.805 | ||
aromaticity | 0.025 | ||
GRAVY | -0.788 | ||
Secondary Structure Fraction | |||
Helix | 0.124 | ||
turn | 0.306 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333572.1 | complete | 121 | 742-377(-) |
Amino Acid sequence : | |||
MRAMPGDARGSVCVAAICRCTSLVCSVVQEYGAAARRRRSKLRRDSALMNQNSTAAHRPAVPLTTAPDTAPSPPDYPDRDSGRYATSHPHDESPASQSPPDDKHPGTVCNSPSHRAQSAA R* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 12,892.181 | ||
Theoretical pI: | 9.257 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 76.805 | ||
aromaticity | 0.025 | ||
GRAVY | -0.788 | ||
Secondary Structure Fraction | |||
Helix | 0.124 | ||
turn | 0.306 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333572.1 | complete | 247 | 52-795(+) |
Amino Acid sequence : | |||
MTQTESAILAHARRCAPAESCGFVVSTPEGERYFPCVNISGEPEAYFRMSPEDWLQAEMQGEIVALVHSHPGGLPWLSEADRRLQVQSDLPWWLVCRGTIHKFRCVPHLTGRRFEHGVTD CYTLFRDAYHLAGIEMPDFHREDDWWRNGQNLYLDNLEATGLYQVPLSAAQPGDVLLCCFGSSVPNHAAIYCGDGELLHHIPEQLSKRERYTDKWQRRTHSLWRHRAWRASAFTGIYNDL VAASTFV* | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 12,892.181 | ||
Theoretical pI: | 9.257 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 76.805 | ||
aromaticity | 0.025 | ||
GRAVY | -0.788 | ||
Secondary Structure Fraction | |||
Helix | 0.124 | ||
turn | 0.306 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333572.1 | complete | 134 | 471-67(-) |
Amino Acid sequence : | |||
MKVRHLNPRQMISIPEQCVTVRHTVLKAPPGEMRHTAELMNRPPADQPPRQITLHLQPPVGLTQPGQTTGVAVDQRHNLTLHFCLQPVFRRHTEIRLRLTGDIHAGEISFPLRRAYHEAA RLRWRTSPGVRQNR* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 12,892.181 | ||
Theoretical pI: | 9.257 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 76.805 | ||
aromaticity | 0.025 | ||
GRAVY | -0.788 | ||
Secondary Structure Fraction | |||
Helix | 0.124 | ||
turn | 0.306 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333572.1 | complete | 121 | 742-377(-) |
Amino Acid sequence : | |||
MRAMPGDARGSVCVAAICRCTSLVCSVVQEYGAAARRRRSKLRRDSALMNQNSTAAHRPAVPLTTAPDTAPSPPDYPDRDSGRYATSHPHDESPASQSPPDDKHPGTVCNSPSHRAQSAA R* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 12,892.181 | ||
Theoretical pI: | 9.257 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 76.805 | ||
aromaticity | 0.025 | ||
GRAVY | -0.788 | ||
Secondary Structure Fraction | |||
Helix | 0.124 | ||
turn | 0.306 | ||
sheet | 0.223 |