Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333574.1 | complete | 134 | 203-607(+) |
Amino Acid sequence : | |||
MKKVTKSKMPKPKHQSNVEREEEEKTLSKPKKMGSEIDEIFAAKKRKRQENEKKSDDAKAAKVAAAKVRPSDKKKRKSSETRSTEEKNSFTDRVSQRRRKTADGLSIFTEEELGIGKPDA GGTALCPFDCDCCF* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,124.070 | ||
Theoretical pI: | 9.573 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
Instability index: | 69.959 | ||
aromaticity | 0.037 | ||
GRAVY | -1.300 | ||
Secondary Structure Fraction | |||
Helix | 0.134 | ||
turn | 0.201 | ||
sheet | 0.246 |