| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333600.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
| KLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEE EYIKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCY | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 16,172.321 | ||
| Theoretical pI: | 5.956 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41605 | ||
| Instability index: | 45.415 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.387 | ||
| turn | 0.246 | ||
| sheet | 0.310 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333600.1 | 5prime_partial | 142 | 720-292(-) |
Amino Acid sequence : | |||
| IASLESWLVVSYERPIENSNRSSKHSLHRALGHALGGSRPENSHWLWATDITVDDWWLHTARPVGLHPAICCEGKTRQLLSKVLNHIVSLWLSMNKNINVELFLQLDNLVYLFLDCLNVL LLGDLVGLEFTAHSSELHSLWE* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,172.321 | ||
| Theoretical pI: | 5.956 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41605 | ||
| Instability index: | 45.415 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.387 | ||
| turn | 0.246 | ||
| sheet | 0.310 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333600.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
| KLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEE EYIKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCY | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 16,172.321 | ||
| Theoretical pI: | 5.956 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41605 | ||
| Instability index: | 45.415 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.387 | ||
| turn | 0.246 | ||
| sheet | 0.310 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333600.1 | 5prime_partial | 142 | 720-292(-) |
Amino Acid sequence : | |||
| IASLESWLVVSYERPIENSNRSSKHSLHRALGHALGGSRPENSHWLWATDITVDDWWLHTARPVGLHPAICCEGKTRQLLSKVLNHIVSLWLSMNKNINVELFLQLDNLVYLFLDCLNVL LLGDLVGLEFTAHSSELHSLWE* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,172.321 | ||
| Theoretical pI: | 5.956 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41605 | ||
| Instability index: | 45.415 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.387 | ||
| turn | 0.246 | ||
| sheet | 0.310 | ||