| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333601.1 | internal | 260 | 782-3(-) |
Amino Acid sequence : | |||
| HTAVDLCNERKLDEEFKSWLAFAAQKIVEVNALAKALCGQKDEAFFSANAAAQASRKSSPRVNNEAVKKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRR EFKAKKITEEEYDKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVYWSTAAQSMTKRPMKGMLTGPVTILNWSFVR NDQPRFETCYQIALAIKDEV | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 29,268.115 | ||
| Theoretical pI: | 9.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31190 | ||
| Instability index: | 38.462 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.459 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.192 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333601.1 | internal | 260 | 782-3(-) |
Amino Acid sequence : | |||
| HTAVDLCNERKLDEEFKSWLAFAAQKIVEVNALAKALCGQKDEAFFSANAAAQASRKSSPRVNNEAVKKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRR EFKAKKITEEEYDKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVYWSTAAQSMTKRPMKGMLTGPVTILNWSFVR NDQPRFETCYQIALAIKDEV | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 29,268.115 | ||
| Theoretical pI: | 9.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31190 | ||
| Instability index: | 38.462 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.459 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.192 | ||
| sheet | 0.281 | ||