| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333603.1 | complete | 161 | 91-576(+) |
Amino Acid sequence : | |||
| MTTTYNQFCNETKAQAQAVAVTGATGASCLVMVVWSSSFLAPTTLSTKFPSLKNKKVGIASILCFSATLLSSSTSTFKNITWGSFLANSAKIGAMKRHGPHHEAVKSTTTNFPDAAPLSN CSFHWSSEWQPITSPSSAEVVLVAISLKKCKIFLRRLPPFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 14,035.798 | ||
| Theoretical pI: | 7.098 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 39.609 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.205 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.262 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333603.1 | complete | 128 | 524-138(-) |
Amino Acid sequence : | |||
| MATSTTSAEEGLVIGCHSEDQWKEQFDKGAASGKLVVVDFTASWCGPCRFIAPILAELAKKLPHVIFLKVDVDELKSVAEKHKIEAMPTFLFFKEGNLVDKVVGARKEELQTTITKHDAP VAPVTATA* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,035.798 | ||
| Theoretical pI: | 7.098 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 39.609 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.205 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.262 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333603.1 | complete | 122 | 174-542(+) |
Amino Acid sequence : | |||
| MFGNGGLELFLPGTHNLVHQVSLLEEQEGRHRLNFVLFRHTLKLVNVHLQEYNVGQFLGQLCQNWCNETAWPTPRSREVYHNQFPGRGALVELFFPLVFGVAANHQSLFSRSSTSSHFLE KM* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 14,035.798 | ||
| Theoretical pI: | 7.098 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 39.609 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.205 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.262 | ||
| sheet | 0.270 | ||