Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333604.1 | complete | 161 | 499-14(-) |
Amino Acid sequence : | |||
MTTTYNQFCNETKAQAQAVAVTGATGASCLVMVVWSSSFLAPTTLSTKFPSLKNKKVGIASILCFSATLLSSSTSTFKNITWGSFLANSAKIGAMKRHGPHHEAVKSTTTNFPDAAPLSN CSFHWSSEWQPITSPSSAEVVLVAISLKKCKIFLRRLPPFS* | |||
Physicochemical properties | |||
Number of amino acids: | 161 | ||
Molecular weight: | 14,035.798 | ||
Theoretical pI: | 7.098 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 39.609 | ||
aromaticity | 0.123 | ||
GRAVY | -0.205 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.262 | ||
sheet | 0.270 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333604.1 | complete | 128 | 66-452(+) |
Amino Acid sequence : | |||
MATSTTSAEEGLVIGCHSEDQWKEQFDKGAASGKLVVVDFTASWCGPCRFIAPILAELAKKLPHVIFLKVDVDELKSVAEKHKIEAMPTFLFFKEGNLVDKVVGARKEELQTTITKHDAP VAPVTATA* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,035.798 | ||
Theoretical pI: | 7.098 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 39.609 | ||
aromaticity | 0.123 | ||
GRAVY | -0.205 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.262 | ||
sheet | 0.270 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333604.1 | complete | 122 | 416-48(-) |
Amino Acid sequence : | |||
MFGNGGLELFLPGTHNLVHQVSLLEEQEGRHRLNFVLFRHTLKLVNVHLQEYNVGQFLGQLCQNWCNETAWPTPRSREVYHNQFPGRGALVELFFPLVFGVAANHQSLFSRSSTSSHFLE KM* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 14,035.798 | ||
Theoretical pI: | 7.098 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 39.609 | ||
aromaticity | 0.123 | ||
GRAVY | -0.205 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.262 | ||
sheet | 0.270 |