| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333610.1 | 5prime_partial | 175 | 3-530(+) |
Amino Acid sequence : | |||
| FQSDLVAFLRSRSKELKPGGSMFLMLLGRTSPDPEDQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPGLEEFKEVVERDGAFIINKLQLFHGGSALIIDDPNDAVEISRAY VSLCRSLTGGLVDAHIGDQLGHELFSRLLSRAVAQAKELMDLFQLVHIVASLTLA* | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 19,452.947 | ||
| Theoretical pI: | 4.925 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 46.895 | ||
| aromaticity | 0.086 | ||
| GRAVY | 0.009 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.217 | ||
| sheet | 0.297 | ||