| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333616.1 | complete | 122 | 287-655(+) |
Amino Acid sequence : | |||
| MLMHATPETRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVQSVVDVGGRHGMAIGKLEEAFPWVRGIAFDLPEVVADAPPRKGVD FV* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,040.719 | ||
| Theoretical pI: | 6.398 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 27.818 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.254 | ||
| sheet | 0.295 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333616.1 | complete | 122 | 287-655(+) |
Amino Acid sequence : | |||
| MLMHATPETRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVQSVVDVGGRHGMAIGKLEEAFPWVRGIAFDLPEVVADAPPRKGVD FV* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,040.719 | ||
| Theoretical pI: | 6.398 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 27.818 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.254 | ||
| sheet | 0.295 | ||