| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333635.1 | 5prime_partial | 212 | 3-641(+) |
Amino Acid sequence : | |||
| LSQIPKEVMEKGSAAYNEGRVTINGAKESTVNAYKKQFQSDLGVFLRSRSKELKPGGSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKE VVERDGAFIINKLQLFHGGSALIIDDPNDAVEISRAYVSLCRSLTGGLVDAHIGDQLGHELFSRLLSQAVDQAKELMDQFQLVHIVASLTLA* | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,464.333 | ||
| Theoretical pI: | 5.133 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 39.609 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.177 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.231 | ||
| sheet | 0.278 | ||