| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333639.1 | 5prime_partial | 205 | 803-186(-) |
Amino Acid sequence : | |||
| QPPPNSVVYAALGSITVLNTAQFRELALGLELAGRPFLWVVRRDSAGEGCFPAGFEARVGRRGKVVGWAPQREVLAHPSVACFISHCGWNSTVEGVSSGVPFLCWPYFADQFCNQDYICD EWKVGLRLEKDENGIVTREEVKEKIESVVGDGGYKKRASNLRARVMDGVRGGKSHANFTNFVDWIHKTQSHCEVENSLVEVEVFI* | |||
Physicochemical properties | |||
| Number of amino acids: | 205 | ||
| Molecular weight: | 19,827.803 | ||
| Theoretical pI: | 11.193 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 69.314 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.571 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.312 | ||
| sheet | 0.208 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333639.1 | complete | 173 | 231-752(+) |
Amino Acid sequence : | |||
| MRLCLMDPIHEISKIRMRFSSSNTIHNSSSKIRSSLFIPSITNNTLNFLLHFFSGHDPIFILLQSQSDLPLIANIVLITELIREIRPTQKRHPTTNPLDSRIPPTMTYKTRHRRVGQHLP LRGPPHHLPPPPHPRLEPRRKTSLSGGVPPHHPQKRPAGELEPEGELPELRRV* | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,827.803 | ||
| Theoretical pI: | 11.193 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 69.314 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.571 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.312 | ||
| sheet | 0.208 | ||