| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333640.1 | internal | 227 | 2-682(+) |
Amino Acid sequence : | |||
| KGMLRMMAAEVEALITKLNRNGGPQITCVIVDWLMAWAVEDAAARIGLRTAVFCPASAASLALTFSIPKLVANGVIDDNNGQLISKQKKIELSPDSPPINTADFYWVGMGTKLLNKNFFH FASKAHHSINSSDWILCNSSPDLEPGILSSLPRFTPIGPLLAANRLSRSAGSFWAEDSTCLTWLHQHPPNSVVYAAFGSITVLNTAQFRELALGLELAGRPFLWVVR | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 24,717.287 | ||
| Theoretical pI: | 8.424 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41730 | ||
| Instability index: | 33.186 | ||
| aromaticity | 0.088 | ||
| GRAVY | 0.168 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.269 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333640.1 | internal | 227 | 2-682(+) |
Amino Acid sequence : | |||
| KGMLRMMAAEVEALITKLNRNGGPQITCVIVDWLMAWAVEDAAARIGLRTAVFCPASAASLALTFSIPKLVANGVIDDNNGQLISKQKKIELSPDSPPINTADFYWVGMGTKLLNKNFFH FASKAHHSINSSDWILCNSSPDLEPGILSSLPRFTPIGPLLAANRLSRSAGSFWAEDSTCLTWLHQHPPNSVVYAAFGSITVLNTAQFRELALGLELAGRPFLWVVR | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 24,717.287 | ||
| Theoretical pI: | 8.424 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41730 | ||
| Instability index: | 33.186 | ||
| aromaticity | 0.088 | ||
| GRAVY | 0.168 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.269 | ||
| sheet | 0.291 | ||